DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG31326

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:314 Identity:79/314 - (25%)
Similarity:131/314 - (41%) Gaps:44/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PIPLDHQNLKPAEQTR-PFE---KQCKQYNEV---RSACQSTPFIVGGTKASGKEFPFMALIGTH 122
            |.|...::..|.:..| |.:   :|....|.:   |....:||.|..|......:.|::..|...
  Fly   230 PTPNPSRSNAPQQAVRSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFER 294

  Fly   123 RPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSP--KFVVRLGELDYNSTTD 185
            |.:...:.|   |||:::....||:||||...         |..|.|  :..|.||.......:|
  Fly   295 RESNGPAFI---CGGTLISTSTVLSAAHCFRA---------PGRDLPASRLAVSLGRNTLAIHSD 347

  Fly   186 DALVQDFR-VVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGN-DVQQ-- 246
            .    :|| |...::|..:..   :|..:.|:|||.||....:.|::..:||...|.. |:.|  
  Fly   348 G----EFRGVSQLIIHENFQF---KQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGL 405

  Fly   247 -VTAAGWGFTADGVKSSHLLKV-NLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGG 309
             ...||||....|..::.:.|| :|...|:..|...|...:...:..||  ..:.|..|..|.||
  Fly   406 KSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCA--KKTGAGPCASDGGG 468

  Fly   310 PIFVQHPLYPCLKQVIGIVSYGLVCGSQGL-----PSVYTKVHLYTDWIESIVW 358
            |:.::......|:   |::|.|::...:..     |||:|.|..:.:|:...:|
  Fly   469 PLMLREQDVWVLR---GVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQKMW 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 68/266 (26%)
Tryp_SPc 102..353 CDD:214473 67/263 (25%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 67/263 (25%)
Tryp_SPc 277..514 CDD:214473 66/260 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.