DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG9649

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:311 Identity:76/311 - (24%)
Similarity:135/311 - (43%) Gaps:46/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PLDHQNLKPAEQTRPFEKQCKQYNEV--RSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKS 129
            |..|.:..||:.::.:.:...|.:.:  |.....||||..|.:....:.|:||.:..|    ...
  Fly   220 PSVHPSNTPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEH----VGR 280

  Fly   130 DINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRV 194
            |.|:.|||:::..:.|::||||......       |....:.:|.||....:..:..|.:   .|
  Fly   281 DYNFLCGGTLISARTVISAAHCFRFGSR-------NLPGERTIVSLGRNSLDLFSSGATL---GV 335

  Fly   195 VNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPD-------SGNDVQQVTAAGW 252
            ...::|..|:.......   |:||::|....:..|::..:||..:       ||:   :...|||
  Fly   336 ARLLIHEQYNPNVYTDA---DLALLQLSNHVDIGDYIKPICLWNENFLLELPSGH---KSYVAGW 394

  Fly   253 GFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSID-------TRTQFCAGSMSSQADTCNGDSGGP 310
            |....|.:::.|.|:.   .:|.:.|...|.::.       |....|| |.:..:..|:|||||.
  Fly   395 GEDEKGNRNTRLAKMT---DTDIITQWECRGNLSEENAKFITSHTICA-SNAQASGPCSGDSGGG 455

  Fly   311 IFVQHPLYPCLKQVIGIVSYGLVCGSQ---GLPSVYTKVHLYTDWIESIVW 358
            :.:|......|:   |:||.|....::   .||.:||.|..:.:|:.|.:|
  Fly   456 LMLQEQDIWMLR---GVVSAGQRMTNRCNLTLPVIYTDVAKHIEWLLSSMW 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 65/270 (24%)
Tryp_SPc 102..353 CDD:214473 64/267 (24%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/267 (24%)
Tryp_SPc 259..497 CDD:214473 63/264 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.