DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG8870

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:405 Identity:104/405 - (25%)
Similarity:161/405 - (39%) Gaps:117/405 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYALPGIQILLLIASVSVVTEYCDNGTG-----ECKELTPSDCP-----VIFYNQHLIGAEVKYC 55
            ::.|.|..:|:|    .::.....||.|     ||..|  ..||     :....:::||  ::.|
  Fly     2 LFGLIGSFLLML----QIILVPYSNGAGCQFDTECVNL--DKCPRTRAVMNSSRKNIIG--LRRC 58

  Fly    56 DEFNDIVCCP-----IPLD---HQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKE 112
            .  .:.||||     :|.|   ....||.:                           |...:..|
  Fly    59 G--TNKVCCPKWETYLPHDTCGQSRRKPTK---------------------------GKIPALNE 94

  Fly   113 FPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFV--VRL 175
            ||:||::.....|.....:...||||:::..:|||||||:|.         |..|.|..:  |||
  Fly    95 FPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEY---------PFMDYPYALKTVRL 150

  Fly   176 GELDYNSTTDDALV----------QDFRVVNYVVHPGYDTEDEEQGFK--NDIALVELDRKAEFN 228
            ||.:.::..|.|:|          .:..|...:.|     |...:|.:  ||||||.|.....:.
  Fly   151 GEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITH-----EQFNRGRRLINDIALVRLKFPVRYT 210

  Fly   229 DHVAAVCLP--PDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQF 291
            ..:..:|||  .......::..|:||.....|:.|..||:..:.....:||:....|::.  :|.
  Fly   211 RAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKSNYDFNLG--SQI 273

  Fly   292 CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVI----------GIVSYG------LVCGSQGLP 340
            |||.:... ||..||||||:         ::.||          ||:|||      ..|    .|
  Fly   274 CAGGLDGN-DTSPGDSGGPL---------METVIRGKVTLTYAAGIISYGQKPCVLKTC----KP 324

  Fly   341 SVYTKVHLYTDWIES 355
            :.|||...:.:||:|
  Fly   325 AFYTKTSYFFEWIKS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/286 (28%)
Tryp_SPc 102..353 CDD:214473 78/282 (28%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 80/277 (29%)
Tryp_SPc 93..337 CDD:214473 77/273 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.