DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG11670

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:314 Identity:89/314 - (28%)
Similarity:138/314 - (43%) Gaps:41/314 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKS 129
            |.|..|:|..........:...:.||:............|.:..:..::|.||.:|....|   .
  Fly   133 PPPNHHRNFHNIFLNTESKVDGENYNKTAETEDLHDDFNGRSIVAPGQYPHMAALGFRNEN---H 194

  Fly   130 DINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRV 194
            :|::.||||::..:|||||||||.|..:..:           :|::|::.......:...|..||
  Fly   195 EIDYKCGGSLISEEFVLTAAHCLTTHGTSPD-----------IVKIGDIKLKEWELNVAPQRRRV 248

  Fly   195 VNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGV 259
            ....:||.|:....    .:||.|::|:|..|:...|..|.|.|.:.....::...|:|.|....
  Fly   249 AQIYLHPLYNASLN----YHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLHTMGYGSTGFAQ 309

  Fly   260 KSSHLL-KVNLQRFSDEVCQKRLRFSIDT-----RTQFCAGSMSSQADTCNGDSGGPIFV----- 313
            ..:::| :::|.....|.|...|.....:     .:|.||.......|||.||||||:.:     
  Fly   310 PQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERR 374

  Fly   314 -------QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWGN 360
                   :|..|    .::||.|||..|.|: ||.|||:|..|.|||.||||.|
  Fly   375 RRRHTSRKHYRY----YLVGITSYGAYCRSE-LPGVYTRVSSYIDWIASIVWPN 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/271 (29%)
Tryp_SPc 102..353 CDD:214473 76/268 (28%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 78/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.