DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG10041

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:276 Identity:70/276 - (25%)
Similarity:112/276 - (40%) Gaps:61/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 STPFI---VGGTKASG--KEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES 157
            |||.:   |..||...  ..:|::..||    ...|......|.|.::..:|||:||||::|:.:
  Fly    30 STPLLATTVSTTKVISFRPRYPYIVSIG----ENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPT 90

  Fly   158 K-------AERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKND 215
            |       |:.|:....:..|||   |..::        ..|||:.                .||
  Fly    91 KQLYVAGGADSLNSRKQTRFFVV---ERRWH--------PQFRVLG----------------GND 128

  Fly   216 IALVELDRKAEFND----HVAAVCLPP-DSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDE 275
            ||::.:..|...:|    .:.....|. |||.   |.:..|||....| |...|.::......::
  Fly   129 IAVLRIYPKFPLDDVRFRSINFAGKPQRDSGT---QASLVGWGRVGVG-KIRKLQEMPFLTMEND 189

  Fly   276 VCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIF--VQHPLYPCLKQVIGIVSYGLVCGSQG 338
            .||:..||........||..:......|:||||.|:.  .:..||       |::|||....:..
  Fly   190 ECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKLY-------GLLSYGRKACTPL 247

  Fly   339 LPSVYTKVHLYTDWIE 354
            .|..:|:::.|:.||:
  Fly   248 KPYAFTRINAYSSWIQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/272 (25%)
Tryp_SPc 102..353 CDD:214473 65/269 (24%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 64/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.