DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG16749

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:85/269 - (31%)
Similarity:126/269 - (46%) Gaps:56/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI----GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERL 162
            :|.||.:|.:::||:..:    |:|           .||||::..:||:|||||  ||..||..|
  Fly    30 VVNGTDSSVEKYPFVISMRGSSGSH-----------SCGGSIISKQFVMTAAHC--TDGRKASDL 81

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
            .         |:.|....|:|..:.:    ||...:.|..|:..:   .:.|||:|:.::...||
  Fly    82 S---------VQYGVTKINATGPNVV----RVKKIIQHEDYNPYN---NYANDISLLLVEEPFEF 130

  Fly   228 ND-HVAAVCLP--------PDSGNDVQQVTAAGWGFTADG--VKSSHLLKVNLQRFSDEVCQKRL 281
            :. .||.|.||        .|:|.:...:   |||..|.|  ::|: |.:|.|:.:|||.|.:|.
  Fly   131 DGVTVAPVKLPELAFATPQTDAGGEGVLI---GWGLNATGGYIQST-LQEVELKVYSDEECTERH 191

  Fly   282 RFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL-VCGSQGLPSVYTK 345
            ....|.|...|.|........|:||||||:...       .|.:||||:.: .|.....|.||.|
  Fly   192 GGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYN-------GQQVGIVSWSIKPCTVAPYPGVYCK 249

  Fly   346 VHLYTDWIE 354
            |..|.|||:
  Fly   250 VSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/269 (32%)
Tryp_SPc 102..353 CDD:214473 83/266 (31%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 83/266 (31%)
Tryp_SPc 30..259 CDD:238113 85/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.