DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG13318

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:368 Identity:94/368 - (25%)
Similarity:141/368 - (38%) Gaps:91/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCP--------IPLDHQNLKPAEQTRPF 82
            ||..|:.:.|..|.                   |.:...|        |.:.:....|...|...
  Fly    87 GTSYCQCVPPGSCA-------------------NPLPTAPSDGSGQIDIRIVNNGGYPTVPTTSS 132

  Fly    83 EKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNK-SKSDINWDC----------- 135
            ...| .|..| :.||:      |:...|:.||......|..|.: |.....|..           
  Fly   133 TLTC-SYGLV-ACCQA------GSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLG 189

  Fly   136 GGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVH 200
            ||:::..:.||||||       |...|...:    |.|||||.|..||::....||..:.|..|:
  Fly   190 GGALITAQHVLTAAH-------KVYNLGLTY----FKVRLGEWDAASTSEPIPAQDVYISNVYVN 243

  Fly   201 PGYDTEDEEQGFKNDIALVELDRKAEFNDH--VAAVCLPPDS--GNDVQQVTAAGWG---FTADG 258
            |.::..:    .:||:|:::|.........  |..||||..|  |   |:...||||   |.|.|
  Fly   244 PSFNPNN----LQNDVAILKLSTPVSLTSKSTVGTVCLPTTSFVG---QRCWVAGWGKNDFGATG 301

  Fly   259 VKSSHLLKVNLQRFSDEVCQKRLR-------FSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHP 316
            ...:...:|::....:..||..|:       |.:...:..|||..:.: |.|.||.|.|:.    
  Fly   302 AYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGK-DACTGDGGSPLV---- 361

  Fly   317 LYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
               |...    |:|:|::|:.|...|:|.||..|..|..||::
  Fly   362 ---CTSNGVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQT 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/284 (28%)
Tryp_SPc 102..353 CDD:214473 77/280 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 73/259 (28%)
Tryp_SPc 169..399 CDD:214473 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.