DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Sp7

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:308 Identity:91/308 - (29%)
Similarity:141/308 - (45%) Gaps:68/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NLKPA-EQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDC 135
            ||.|: .:..|.....|.||              |...:..||.:|||: .:..|:.:.:::  |
  Fly   120 NLLPSPPKCGPHSFSNKVYN--------------GNDTAIDEFNWMALL-EYVDNRGRRELS--C 167

  Fly   136 GGSVVHPKFVLTAAHC-LETDESKAERLDPNFDSPKFVVRLGELDYNSTTD------DALVQDFR 193
            |||:::.::||||||| :...|::...|.        .|||||.|.:...|      :..:....
  Fly   168 GGSLINNRYVLTAAHCVIGAVETEVGHLT--------TVRLGEYDTSKDVDCIDDICNQPILQLG 224

  Fly   194 VVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG----NDVQQVTAAGWGF 254
            :....|||.||..::.:  .:||||:.|||....|:::..||||..|.    |..:.:..:|||.
  Fly   225 IEQATVHPQYDPANKNR--IHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGR 287

  Fly   255 TADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTR------TQFCAGSMSSQADTCNGDSGGPI-- 311
            |....||:...:::|.....:.|.::..    ||      :|.|.|. ....|:|:||||||:  
  Fly   288 TTTARKSTIKQRLDLPVNDHDYCARKFA----TRNIHLISSQLCVGG-EFYRDSCDGDSGGPLMR 347

  Fly   312 ------FVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
                  :.|.          |:||:|..||.:|.|.|||:|..|.|||
  Fly   348 RGFDQAWYQE----------GVVSFGNRCGLEGWPGVYTRVADYMDWI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/277 (30%)
Tryp_SPc 102..353 CDD:214473 82/275 (30%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 85/290 (29%)
Tryp_SPc 137..388 CDD:238113 86/291 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.