DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Mcpt1l3

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_038949770.1 Gene:Mcpt1l3 / 408209 RGDID:1302933 Length:270 Species:Rattus norvegicus


Alignment Length:266 Identity:76/266 - (28%)
Similarity:114/266 - (42%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            ||||.::.....|:||.:   :....|..:.: |||.::..:||||||||               
  Rat    42 IVGGVESIPHSRPYMAHL---KITTEKGYVTF-CGGFLISRQFVLTAAHC--------------- 87

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN--DIALVELDRKAEFND 229
            :..:..|.||..|.:..  ::..|..:|...::|..|:.      |.|  ||.|::|:::.|...
  Rat    88 NGREITVTLGAHDVSKR--ESTQQKLKVEKQIIHKNYNF------FSNIHDIMLLKLEKQVELTP 144

  Fly   230 HVAAVCLPP-----DSGNDVQQVTAAGWGFTADGVKSSH---LLKVNLQRFSDEVCQKRLRFSID 286
            .|..|.||.     |.|...|   |||||.|.....:|:   |.:|.|:....|.|  ::....|
  Rat   145 AVDVVPLPSPSDFIDPGTMCQ---AAGWGQTGVTDPTSYTYTLREVELRIMDVEAC--KIFSDYD 204

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTD 351
            ...|.|.||.........||||||:.       |.....||||:|......  |:|:|::..|..
  Rat   205 YNFQMCVGSPGRMRSPYEGDSGGPLL-------CAGVAHGIVSHGREDAKP--PAVFTRISPYVP 260

  Fly   352 WIESIV 357
            ||..::
  Rat   261 WINIVL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/263 (29%)
Tryp_SPc 102..353 CDD:214473 74/260 (28%)
Mcpt1l3XP_038949770.1 Tryp_SPc 42..263 CDD:238113 75/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.