DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and MP1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:422 Identity:122/422 - (28%)
Similarity:183/422 - (43%) Gaps:109/422 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLIASVSVVTE----YC---DNGTGECKELTPSDCPVIF----------YNQHLIGA------- 50
            :||:.:.|...:    ||   |..:|.|..|  .:|..:|          .::..:.|       
  Fly    12 MLLMGTSSTYAQEIFGYCRTPDENSGTCINL--RECGYLFELLQSEEVTEQDRRFLQASQCGYRN 74

  Fly    51 ----EVKYCDEFNDI-VCC-------PIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPF-- 101
                |..:|  |.:: :||       ..|....:.:|.:.|:|.:         ||..:..|.  
  Fly    75 GQVLEKHFC--FTNVQICCANSRMRNQQPQWGNHPQPTQTTKPTK---------RSGTKLLPMAP 128

  Fly   102 ---------IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES 157
                     :|||.:.:.:|||:||||...:|...|..   .||||:::.::|||||||:....|
  Fly   129 NCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGH---HCGGSLINHRYVLTAAHCVSAIPS 190

  Fly   158 KAERLDPNFDSPKFVVRLGELDYNSTTDDALV------------QDFRVVNYVVHPGYDTEDEEQ 210
            ..|...         |||||.| .||..|..|            .|:.|...:.||.|.....:|
  Fly   191 DWELTG---------VRLGEWD-ASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQ 245

  Fly   211 GFKNDIALVELDRKAEFNDHVAAVCLP--PDSGNDV---QQVTAAGWGFTADGVKSSHLLKVNLQ 270
              .|||||:.|..:.:::|.:..||||  ....|::   ::|..||||.|.....|:..||..|.
  Fly   246 --LNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELD 308

  Fly   271 RFSDEVCQKRLRFSIDTRT----QFCAGSMSSQADTCNGDSGGPIFVQ-----HPLYPCLKQVIG 326
            ......|.:  |::...||    |.|||.:.. .|:|.||||||:.::     :..|    .:.|
  Fly   309 TVPTSECNQ--RYATQRRTVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNSNY----YIAG 366

  Fly   327 IVSYG-LVCGSQGLPSVYTKVHLYTDWIESIV 357
            :|||| ..||.:|.|.|||:|..|.:|||:.|
  Fly   367 VVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 97/280 (35%)
Tryp_SPc 102..353 CDD:214473 94/277 (34%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855 11/65 (17%)
Tryp_SPc 137..394 CDD:214473 94/278 (34%)
Tryp_SPc 138..397 CDD:238113 97/280 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.