DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG11037

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:256 Identity:66/256 - (25%)
Similarity:107/256 - (41%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LIGTHRPNKSK---------SDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVV 173
            :||.|....:|         .:.::.|||::::...|||||||. ....||.         :::|
  Fly    62 VIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCF-LGRMKAS---------EWIV 116

  Fly   174 RLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND----HVAAV 234
            ..|..:.|.......|:||.:         ..:..|.....|:|:|.|....:..:    .:.:|
  Fly   117 AAGISNLNQKGIRRHVKDFIL---------SEQFREDDMNMDVAVVLLKTPLKAKNIGTLSLCSV 172

  Fly   235 CLPPDSGNDVQQVTAAGWGFTADGVKSSH--LLKVNLQRFSDEVCQKRLRFSID-TRTQFCAGSM 296
            .|.|.     .::..:|||.||...:..|  |..|.:.....:.|:...:.:.. |.:..|| ::
  Fly   173 SLKPG-----VELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICA-AV 231

  Fly   297 SSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            ..:.|.|..|||||:..:       |||.||||:|:.|.|...|.|||.|.....:||..:
  Fly   232 LGRKDACTFDSGGPLVFK-------KQVCGIVSFGIGCASNRYPGVYTDVMYVKPFIEKSI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 66/253 (26%)
Tryp_SPc 102..353 CDD:214473 64/250 (26%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 64/250 (26%)
Tryp_SPc 62..283 CDD:238113 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.