DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Sems

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:294 Identity:83/294 - (28%)
Similarity:121/294 - (41%) Gaps:79/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGG-----TKASGKEFPFMALIGTHRPNKSKSDIN 132
            |.||.|||                     ::||     .|..|      .|:.....|      |
  Fly    36 LPPAYQTR---------------------VIGGRVTTNAKLGG------YLVAMRYFN------N 67

  Fly   133 WDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQ-DFRVVN 196
            :.|||:::|...|||||||.   |.:||:...:.|..  :.||.|..........:.. .|::|.
  Fly    68 FICGGTLIHELIVLTAAHCF---EDRAEKEAWSVDGG--ISRLSEKGIRRQVKRFIKSAQFKMVT 127

  Fly   197 YVVHPGYDTEDEEQGFKNDIALVELDR-KAEFNDHVAAVC---LPPDSGNDVQQVTAAGWGFT-A 256
                           ...|:|:|.|:| ....|....::|   |.|....||     :|||.| .
  Fly   128 ---------------MNMDVAVVLLNRPMVGKNIGTLSLCSTALTPGQTMDV-----SGWGMTNP 172

  Fly   257 DGVKSSHLLK-VNLQRFSDEVCQKRLRFSID-TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYP 319
            |.....|:|: |::......:|::..|.|:. :.:.||| |:..:.|.|..|||||:..:     
  Fly   173 DDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCA-SVLGKKDACTYDSGGPLVYE----- 231

  Fly   320 CLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
              |||.||||:|:.|.|:..|.|||.||....:|
  Fly   232 --KQVCGIVSFGIGCASRRYPGVYTDVHYVKPFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/265 (29%)
Tryp_SPc 102..353 CDD:214473 76/263 (29%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 77/285 (27%)
Tryp_SPc 44..265 CDD:238113 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.