DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG9372

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:368 Identity:109/368 - (29%)
Similarity:167/368 - (45%) Gaps:66/368 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASVSVVTEYCDNG--------TGECKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDH 70
            |..|.:.|..|.|        :|.|:.:.....|.:..:...:.:::...::.:..:||......
  Fly    73 APTSQLLENKDYGACSTPLGESGRCRHIIYCRMPELKNDVWRLVSQLCIIEKSSIGICCTDQSTS 137

  Fly    71 QNLKPAEQT-----------RPFEKQC----KQYNEVRSACQSTPFIVGGTKASGKEFPFM-ALI 119
            ....|...|           :|.::.|    :|:          |.:.||..|...|:|:| ||:
  Fly   138 NRFSPQVVTSADGDEPRIVNKPEQRGCGITSRQF----------PRLTGGRPAEPDEWPWMAALL 192

  Fly   120 GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNS-T 183
            ....|      ..| |||.::..:.|||||||:    .|..:.|       ..|||||  ||: .
  Fly   193 QEGLP------FVW-CGGVLITDRHVLTAAHCI----YKKNKED-------IFVRLGE--YNTHM 237

  Fly   184 TDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPP--DSGNDVQQ 246
            .::...:|||:.|.|:|..|:    .|.:.||||:|.:||...||.::..||:||  :..:| :.
  Fly   238 LNETRARDFRIANMVLHIDYN----PQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSD-RN 297

  Fly   247 VTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGP 310
            ....|||... .|..|:.|::|||..:....|:......:.. |..|||......|:|.||||||
  Fly   298 AIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPD-TAMCAGFPEGGQDSCQGDSGGP 361

  Fly   311 IFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            :.||.|....:  .|||||:|:.||.:|.|.:||:|..|.|||
  Fly   362 LLVQLPNQRWV--TIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 93/257 (36%)
Tryp_SPc 102..353 CDD:214473 91/255 (36%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 4/44 (9%)
Tryp_SPc 173..402 CDD:214473 91/256 (36%)
Tryp_SPc 176..402 CDD:238113 91/253 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.