DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG6865

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:313 Identity:94/313 - (30%)
Similarity:148/313 - (47%) Gaps:69/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LKPAEQTRPFEKQ-CKQYNEVRSACQSTPFIVGGTKASGKEFPFMALI---GTHRPNKSKSDINW 133
            :|.|:....|..| |...|         |.||||::|...|.|:|..:   |.|           
  Fly    14 VKCAQSQIAFSNQPCSVRN---------PKIVGGSEAERNEMPYMVSLMRRGGH----------- 58

  Fly   134 DCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTD---------DALV 189
            .|||:::..:::|||.||:.....:       |..|..:  .|.:..:|..:         |||.
  Fly    59 FCGGTIISERWILTAGHCICNGLQQ-------FMKPAQI--QGVVGLHSIREYLNGIGNGPDALR 114

  Fly   190 QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGN---DVQQVTAAG 251
            .||:  |.|.||.||..|    .|:||||:||.:...|:.|:...|:..:.|:   :.:..|.:|
  Fly   115 VDFK--NIVPHPQYDCND----VKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSG 173

  Fly   252 WGFT----ADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDT-----RTQFCAGSMSSQADTCNGDS 307
            ||:|    |:..:|..|.|..::.:::|.|::..| |:..     .||.|||..:.|.|:|..||
  Fly   174 WGWTHENQAENDRSDVLRKATVKIWNNEACERSYR-SLGKSNTIGETQLCAGYENGQIDSCWADS 237

  Fly   308 GGPIF-VQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWG 359
            |||:. .:|.|       :|:||.|:.|...|||.:||:|..|..|::.::.|
  Fly   238 GGPLMSKEHHL-------VGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVIDG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 86/278 (31%)
Tryp_SPc 102..353 CDD:214473 85/275 (31%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 85/275 (31%)
Tryp_SPc 35..280 CDD:238113 86/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.