DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG7542

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:270 Identity:77/270 - (28%)
Similarity:120/270 - (44%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            |:|..|..|...:||:.|.:.....|.|    .| |||:::...:::|||||::..||       
  Fly    25 PYITNGEPAEVGQFPYQAGLNVSFGNWS----TW-CGGTLISHYWIITAAHCMDGAES------- 77

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVV---NYVVHPGYDTEDEEQGFKNDIALVELDRKAE 226
                  ..|.||.::....:::.  |:..:|   ..:||..|....    ..|||:|:.|.....
  Fly    78 ------VTVYLGAINIGDESEEG--QERIMVEKSGIIVHSNYMAST----VVNDISLIRLPAFVG 130

  Fly   227 FNDHVAAVCLPPDSGNDVQ-----QVTAAGWGFTADGVKS-SHLLK-VNLQRFSDEVCQKRLRFS 284
            |.|.:.|..||........     :..|:|||..:|...| |.:|: |.:......:|  |:.:|
  Fly   131 FTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC--RMYWS 193

  Fly   285 IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ-----VIGIVSYGLVCGSQ-GLPSVY 343
            .....:....|.:|...||:||||||:     :|   ||     :||..|:|...|.| |.|:|:
  Fly   194 GAVSEKMICMSTTSGKSTCHGDSGGPL-----VY---KQGNSSYLIGSTSFGTSMGCQVGFPAVF 250

  Fly   344 TKVHLYTDWI 353
            |::..|.|||
  Fly   251 TRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/268 (28%)
Tryp_SPc 102..353 CDD:214473 74/266 (28%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 76/268 (28%)
Tryp_SPc 27..260 CDD:214473 74/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.