DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and cfd

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_989320.1 Gene:cfd / 394945 XenbaseID:XB-GENE-973605 Length:265 Species:Xenopus tropicalis


Alignment Length:268 Identity:75/268 - (27%)
Similarity:117/268 - (43%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CQSTPFIVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES 157
            |:....|:||..:..:..|:||.|   |.|:           |||.::..|:||:||||.     
 Frog    21 CRPRGRILGGQDSKAEVRPYMASIQQNGIHQ-----------CGGVLIADKWVLSAAHCA----- 69

  Fly   158 KAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELD 222
                  .|..:....|.||.:..:......:|  .:|:..:.||.|::..:.    :|:.|:||.
 Frog    70 ------TNSSNSSLNVMLGAISLSKPEKYKIV--VKVLREIPHPLYNSTIKH----HDLLLLELS 122

  Fly   223 RKAEFNDHVAAVCLPPDSGN-DV---QQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLR 282
            .|...:..|..  ||..:.| |:   ::...|||| ....|.|...|.::.:...|.:||.:|..
 Frog   123 EKVTLSPAVNP--LPFQNENIDISAGKRCLVAGWGQMRLTGKKPDTLQELWVPLISRDVCNRRNY 185

  Fly   283 FSID-TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL-VCGSQGLPSVYTK 345
            :..: |....|||  .|:.|:|.||||||:.       |....:.||..|. .||:...|.:||.
 Frog   186 YDNEITANMICAG--ESRKDSCEGDSGGPLV-------CDGIAVAIVQGGFRKCGNPTKPGIYTL 241

  Fly   346 VHLYTDWI 353
            :..|..||
 Frog   242 IEPYKSWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/262 (28%)
Tryp_SPc 102..353 CDD:214473 72/260 (28%)
cfdNP_989320.1 Tryp_SPc 27..251 CDD:238113 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.