DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG4477

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:244 Identity:68/244 - (27%)
Similarity:101/244 - (41%) Gaps:52/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 NWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDY-----NST-----TDD 186
            |..|.|.::.|.||:|:||||   .:|...|   ..|...::..|.|:.     |.|     |..
  Fly    69 NHFCSGVILAPMFVMTSAHCL---INKRRVL---ISSRVLLIVAGTLNRLKYIPNRTFVTPVTHI 127

  Fly   187 ALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF---NDHVAAVCLPPDSGNDVQQVT 248
            .|...|.:.|                |.|..|:::  |..|   |:|::...||........:..
  Fly   128 WLPDSFTMRN----------------KQDFGLLKV--KNPFPRNNEHISIARLPVHPPLPGLKCK 174

  Fly   249 AAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCA---GSMSSQADTCNGDSGG 309
            ..||| ....|..:|::|.:::|....|.|.|.||  :.:....||   ..:::| ..|.||.|.
  Fly   175 VMGWGRMYKGGPLASYMLYIDVQVIDSEACAKWLR--VPSVEHVCAVDSDDLTAQ-QPCGGDWGA 236

  Fly   310 PIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI-ESIV 357
            |:.....:|       |||:....||...|||:||.||...:|| |.|:
  Fly   237 PMLHNGTVY-------GIVTILAGCGVSHLPSLYTNVHSNANWIHEKII 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/241 (28%)
Tryp_SPc 102..353 CDD:214473 64/237 (27%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 66/240 (28%)
Tryp_SPc 55..273 CDD:214473 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.