DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG10469

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:128/267 - (47%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF-MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPN 165
            |:.||.|..|:.|: :.|:.....:|.:.::   |||:::..::::||||||:         ||.
  Fly    24 IMNGTAAKAKQLPYQVGLLCYFEGSKDEPNM---CGGTILSNRWIITAAHCLQ---------DPK 76

  Fly   166 FDSPKFVVRLGELDYNSTTDDALVQDFRVVN---YVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
            .:..|.::.:|::   .:.||..:    |||   .:||..:|    .:...|||||::|.:|..|
  Fly    77 SNLWKVLIHVGKV---KSFDDKEI----VVNRSYTIVHKKFD----RKTVTNDIALIKLPKKLTF 130

  Fly   228 NDHVAAVCLPPDSGNDV-QQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQ- 290
            |.::....||....... ::...:|||.|...:.|..|..:.....|::.|:::....:..::: 
  Fly   131 NKYIQPAKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKK 195

  Fly   291 ------FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL--VCGSQGLPSVYTKVH 347
                  .|..  |.:...|.||||||:.:...    .:.::||||:|.  .|..: ||.|.|:|.
  Fly   196 VVHNGFICID--SKKGLPCRGDSGGPMVLDDG----SRTLVGIVSHGFDGECKLK-LPDVSTRVS 253

  Fly   348 LYTDWIE 354
            .|..||:
  Fly   254 SYLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 71/267 (27%)
Tryp_SPc 102..353 CDD:214473 69/264 (26%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 69/264 (26%)
Tryp_SPc 24..260 CDD:238113 70/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.