DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:263 Identity:78/263 - (29%)
Similarity:121/263 - (46%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |..|..|:..:||:.  :|....:.|.|   |.||||::...:|||||||  |..:.|.      
  Fly    40 ITNGKTATSGQFPYQ--VGLSFASTSGS---WWCGGSIIDNTWVLTAAHC--TSGASAV------ 91

  Fly   167 DSPKFVVRLGELDYNST--TDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
                      .:.|.:|  |...|||.....|:|.|..|::    ...:|||:|::....| |..
  Fly    92 ----------TIYYGATVRTSAQLVQTVSADNFVQHASYNS----IVLRNDISLIKTPTVA-FTA 141

  Fly   230 HVAAVCLPPDSGN----DVQQVTAAGWGFTADGVKS-SHLLKVNL-QRFSDEVCQKRLRFSIDTR 288
            .:..|.||..:|.    ..||..|:|||.|:|...| ::.|:..: :..|...||......:.|.
  Fly   142 LINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATN 206

  Fly   289 TQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQ-GLPSVYTKVHLYTDW 352
            ...|..: .::..|||||||||:.:...     .::||:.|:....|.: |.|:.:|:|..|.||
  Fly   207 NVICVAT-PNKVSTCNGDSGGPLVLVSD-----SKLIGVTSFVSSAGCESGAPAGFTRVTSYLDW 265

  Fly   353 IES 355
            |::
  Fly   266 IKT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/263 (30%)
Tryp_SPc 102..353 CDD:214473 76/259 (29%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 76/259 (29%)
Tryp_SPc 40..269 CDD:238113 78/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.