DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and mas

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:121/266 - (45%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF-MALIGTHRPNKSKSDIN-WDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            :|||......|:.: :|||         :.:| :.||.:::..::|||||||:.......:.:  
  Fly   803 VVGGEDGENGEWCWQVALI---------NSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAI-- 856

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
                   .||:|:.|..........|..||....:|..:::    |...|||||::|..:||..|
  Fly   857 -------YVRVGDYDLTRKYGSPGAQTLRVATTYIHHNHNS----QTLDNDIALLKLHGQAELRD 910

  Fly   230 HVAAVCLPPDSGNDV--QQVTAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKRL-----RFSID 286
            .|..||||....:..  ::.|..|:|:..: |.....:.:..:...||..|.:::     :..|.
  Fly   911 GVCLVCLPARGVSHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFIL 975

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTD 351
            ..:.||||..... |.|.||.|||:..|...:   .::.|:||:|..||.|.:|.||.|...:..
  Fly   976 PASSFCAGGEEGH-DACQGDGGGPLVCQDDGF---YELAGLVSWGFGCGRQDVPGVYVKTSSFIG 1036

  Fly   352 WIESIV 357
            ||..|:
  Fly  1037 WINQII 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/263 (28%)
Tryp_SPc 102..353 CDD:214473 71/260 (27%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 73/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.