DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG32277

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:277 Identity:81/277 - (29%)
Similarity:117/277 - (42%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |.||.....|:..|  |:...|..|.:      |||.::.|..|||||||||....:...|..:.
  Fly    27 IFGGKTTLVKDHSF--LVNLRRGGKFR------CGGVIISPNCVLTAAHCLEGRYQQVRDLTVHA 83

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYV-VHPGYDTEDEEQGFKNDIALVELDR------- 223
            ...    .||        ||...:..|...|| :.|.|..   ::|..:|:|::.|.|       
  Fly    84 QQQ----CLG--------DDMPPEHVRSAWYVGLSPNYCA---QRGLDSDLAVIRLSRPFDIAGN 133

  Fly   224 ----KAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSH-----LLKVNLQRFSDEVCQK 279
                |.::||      |||.|     .:|..|||...:   ..|     |.:.|::..|...|.|
  Fly   134 ASLVKIDYND------LPPHS-----NLTVLGWGAINE---QGHNWNQCLQEANVKLISHRECIK 184

  Fly   280 RL--RFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSV 342
            .:  .:...|...|||...::: |.|.||||||     .:|  ..:.:||||:|..||| |.|.|
  Fly   185 SVGSGWQKVTNNMFCALGKNAR-DACQGDSGGP-----AIY--AGRSVGIVSWGYGCGS-GYPGV 240

  Fly   343 YTKVH--LYTDWIESIV 357
            ||::.  ..|.|::..:
  Fly   241 YTRLSSPSITYWLKDFI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/274 (30%)
Tryp_SPc 102..353 CDD:214473 80/271 (30%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 79/264 (30%)
Tryp_SPc 27..246 CDD:238113 79/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.