DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and KLKB1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:384 Identity:96/384 - (25%)
Similarity:151/384 - (39%) Gaps:95/384 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PGIQI------LLLIASVSVVTEYCDNGTGECK----ELTPSDCP------------------VI 41
            ||:..      :..:..|:|..|.|.... .|:    .|.|.||.                  :.
Human   309 PGVDFGGEELNVTFVKGVNVCQETCTKMI-RCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIA 372

  Fly    42 FYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGT 106
            :..|...|..::.|:..::.||                               ..:::..|||||
Human   373 YGTQGSSGYSLRLCNTGDNSVC-------------------------------TTKTSTRIVGGT 406

  Fly   107 KASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKF 171
            .:|..|:|:...:......:...     ||||::..::|||||||              ||....
Human   407 NSSWGEWPWQVSLQVKLTAQRHL-----CGGSLIGHQWVLTAAHC--------------FDGLPL 452

  Fly   172 --VVRL--GELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVA 232
              |.|:  |.|:.:..|.|......:.:  ::|..|...:.    .:||||::|.....:.:...
Human   453 QDVWRIYSGILNLSDITKDTPFSQIKEI--IIHQNYKVSEG----NHDIALIKLQAPLNYTEFQK 511

  Fly   233 AVCLPP--DSGNDVQQVTAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAG 294
            .:|||.  |:..........||||:.: |...:.|.|||:...::|.||||.:....|:...|||
Human   512 PICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAG 576

  Fly   295 SMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ......|.|.||||||:..:|   ..:.:::||.|:|..|..:..|.|||||..|.|||
Human   577 YKEGGKDACKGDSGGPLVCKH---NGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/259 (31%)
Tryp_SPc 102..353 CDD:214473 78/257 (30%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519 13/77 (17%)
Tryp_SPc 401..632 CDD:214473 78/258 (30%)
Tryp_SPc 402..632 CDD:238113 78/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.