DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and tpr

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:266 Identity:75/266 - (28%)
Similarity:122/266 - (45%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||.:....::|::|::   |           .:.|..|:::.:|:|||:||:.          
  Fly   127 IVGGQETEVHQYPWVAMLLYGG-----------RFYCAASLLNDQFLLTASHCVY---------- 170

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
             .|...:..|||.|.|...:....:  |.:|...:.||.|:.    :.:.||||:::||...|||
  Fly   171 -GFRKERISVRLLEHDRKMSHMQKI--DRKVAEVITHPKYNA----RNYDNDIAIIKLDEPVEFN 228

  Fly   229 DHVAAVCLP-PDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQF 291
            :.:..||:| |......:.....||| ....|..|..|.:|.:...|.:.|:|....:..|....
  Fly   229 EVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNML 293

  Fly   292 CAGSMSSQADTCNGDSGGPIFV------QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYT 350
            |.|......|:|.||||||:.:      :|       |:.|:||:|..|...|.|.||.:|:.|.
  Fly   294 CGGYDEGGKDSCQGDSGGPLHIVASGTREH-------QIAGVVSWGEGCAKAGYPGVYARVNRYG 351

  Fly   351 DWIESI 356
            .||:::
  Fly   352 TWIKNL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/264 (28%)
Tryp_SPc 102..353 CDD:214473 73/261 (28%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 73/261 (28%)
Tryp_SPc 127..356 CDD:238113 75/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.