DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG10764

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:287 Identity:91/287 - (31%)
Similarity:135/287 - (47%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLT 147
            |.:..::.|......:.|.|.||..|:.....:||.|.    |.|    ::.|||:::|.:|||:
  Fly    19 ENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIF----NSS----DFQCGGTIIHMRFVLS 75

  Fly   148 AAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGF 212
            |||||..          .:|   ..||||..:.|   :.|.|.  .|:|..||..:...:    :
  Fly    76 AAHCLVR----------GYD---LYVRLGARNIN---EPAAVH--TVINVFVHHDFIASE----Y 118

  Fly   213 KNDIALVELDRKAEFNDHVAAVC--LPPDSGNDVQQV---TAAGWGFTADGVKSSHLLKVNLQRF 272
            :|||.|::|.....:...|..:|  |.|.....|:::   .|.||| ..:|..|..|..:.|...
  Fly   119 RNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWG-NRNGKLSIMLQTIYLLHL 182

  Fly   273 SDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQV---IGIVSYG-LV 333
            ....|:::|.|::::| |.|||  :...|||.||||||:.. :.|:|..|..   :||||:| ..
  Fly   183 KRNECKRKLNFNLNSR-QICAG--TKNGDTCRGDSGGPLST-NILFPSNKSYEVQLGIVSFGDPE 243

  Fly   334 CGSQGLPSVYTKVHLYTDWIESIVWGN 360
            |...|   |||.|..|.|||.|.:..|
  Fly   244 CRGVG---VYTDVTSYVDWISSTIARN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 86/262 (33%)
Tryp_SPc 102..353 CDD:214473 84/259 (32%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 84/260 (32%)
Tryp_SPc 38..263 CDD:238113 86/262 (33%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.