DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG8299

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:123/270 - (45%) Gaps:46/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SACQSTPFIVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDE 156
            ||..|| .||||.:|...:||:...:  .|:.       :...||||:..|:.|:|||||::...
  Fly    21 SASIST-HIVGGDQADIADFPYQVSVRLETYM-------LLHICGGSIYAPRVVITAAHCIKGRY 77

  Fly   157 SKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVEL 221
            :...|:....:|      :.:|:         .|..:|...:.|.||:    ::.:.|||.|:..
  Fly    78 ASYIRIVAGQNS------IADLE---------EQGVKVSKLIPHAGYN----KKTYVNDIGLIIT 123

  Fly   222 DRKAEFN---DHVAAVCLPPDSGNDVQQVTAAGWGFTA--DGVKSSHLLKVNLQRFSDEVC--QK 279
            ....|::   ..:|.....|.||   .|...:|||..|  |....:.|..|.||......|  |.
  Fly   124 REPLEYSALVQPIAVALEAPPSG---AQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQY 185

  Fly   280 RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYT 344
            ..:....|....|||.:....||||||||||:.|...|       :|:||:|:.||.:|.|.|||
  Fly   186 LTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVL-------VGVVSWGVGCGREGFPGVYT 243

  Fly   345 KVHLYTDWIE 354
            .|:.:.||||
  Fly   244 SVNSHIDWIE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/262 (31%)
Tryp_SPc 102..353 CDD:214473 77/259 (30%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 77/260 (30%)
Tryp_SPc 28..255 CDD:238113 80/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.