DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss4

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:373 Identity:102/373 - (27%)
Similarity:153/373 - (41%) Gaps:61/373 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PGIQILL---------LIASVSVVTEYC-DNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFN 59
            ||:.:.|         |.|:.......| ||.|   :.|..:.|..:.||.......|:.... .
  Rat   141 PGVTVRLSKDRSTLQVLDAARGTWASVCFDNFT---EALAKTACRQMGYNSQPAFGPVEMGPN-Q 201

  Fly    60 DIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSAC------QSTPFIVGGTKASGKEFPFMAL 118
            .::..|:..:.|.|    |.:...:.|...:.|...|      ..|..:|||.:||...:|:...
  Rat   202 TLLVTPVTGNSQEL----QMQNGSRSCLSGSLVSLRCLDCGKSLKTTRVVGGVEASADSWPWQVS 262

  Fly   119 IGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNST 183
            |..::.:.        ||||::...::||||||..          ...|...:.||.|.....::
  Rat   263 IQYNKQHV--------CGGSILDHHWILTAAHCFR----------KYLDVSSWKVRAGSNKLGNS 309

  Fly   184 TDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP--PDSGNDVQQ 246
            ....:.:.|     :..|     :..|..:.|||||:|.....|:..|..:|||  .:.......
  Rat   310 PSLPVAKIF-----IAEP-----NPLQPKEKDIALVKLKMPLTFSGSVRPICLPFSDEELIPTMP 364

  Fly   247 VTAAGWGFTAD--GVKSSHLLKVNLQRFSDEVCQKRLRFSID-TRTQFCAGSMSSQADTCNGDSG 308
            |...|||||.:  |..|..||:.::|......|.....:..: |....|||:.....|||.||||
  Rat   365 VWVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGEVTAGMLCAGTPQGGKDTCQGDSG 429

  Fly   309 GPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            ||:...:..:    ||:||||:|..|||...|.|||||..|.|||.::
  Rat   430 GPLMYHYDKW----QVVGIVSWGYGCGSPSTPGVYTKVTAYLDWIYNV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/258 (31%)
Tryp_SPc 102..353 CDD:214473 78/255 (31%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 18/96 (19%)
Tryp_SPc 245..470 CDD:214473 78/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.