DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001004020.1 Gene:Tmprss11b / 365265 RGDID:1303278 Length:420 Species:Rattus norvegicus


Alignment Length:270 Identity:84/270 - (31%)
Similarity:121/270 - (44%) Gaps:58/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHC-LETDESKAERL 162
            |.||:.|...|:|:.|.:   |.|.           ||.|::..:|:|||||| |.|        
  Rat   189 ITGGSTAQKGEWPWQASLRVNGKHH-----------CGASLIGERFLLTAAHCFLRT-------- 234

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQG-FKNDIALVELDRKAE 226
                ::||.:.    :.:.:....|.:|.: |...::|     ||..:| ..:|:|:::|..|..
  Rat   235 ----NNPKNLT----VSFGTRVTPAYMQHY-VEEVIIH-----EDYVKGQHHDDVAIIKLTEKVS 285

  Fly   227 FNDHVAAVCL-------PPDSGNDVQQVTAAGWGFTADGVKSSHLL-KVNLQRFSDEVCQKRLRF 283
            |.:.|..|||       ||..|     |...|||..:...||..|| |.:::......|.....:
  Rat   286 FRNDVHRVCLPEATQVFPPGEG-----VVVTGWGSLSYNGKSPLLLQKASIKIIDTNACNSEEAY 345

  Fly   284 S---IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTK 345
            .   :|  |..|||.|....|.|.||||||:.  ||....:..::||||:|..||....|.||.:
  Rat   346 GGRIMD--TMLCAGYMEGYVDACQGDSGGPLV--HPNSRDIWYLVGIVSWGHECGRVNKPGVYMR 406

  Fly   346 VHLYTDWIES 355
            |..|.|||.|
  Rat   407 VTSYRDWIAS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/270 (31%)
Tryp_SPc 102..353 CDD:214473 81/266 (30%)
Tmprss11bNP_001004020.1 SEA 50..144 CDD:279699
Tryp_SPc 188..414 CDD:214473 81/266 (30%)
Tryp_SPc 189..417 CDD:238113 84/270 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.