DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss56

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:264 Identity:83/264 - (31%)
Similarity:121/264 - (45%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMA---LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||:.|....:|::.   |.|...           |||.:|...:|||||||.....::.    
  Rat   112 IVGGSTAPLGAWPWLVRLQLGGLPL-----------CGGVLVAASWVLTAAHCFAGASNEL---- 161

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVV-HPGYDTEDEEQGFKNDIALVELDRKAEF 227
                  .:.|.|.|.......::  ||    ||.:: ||.:|    .|.|.||:|||:|......
  Rat   162 ------LWTVMLAEGPQGEQAEE--VQ----VNRILPHPKFD----PQTFHNDLALVQLWTPVNS 210

  Fly   228 NDHVAAVCLP-----PDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSID 286
            ......:|||     |.:|.   ..|.|||| ...||.:|..:.:..:...|.:.|||.|...:.
  Rat   211 EGPARPICLPEGSREPPAGT---PCTIAGWGALFEDGPESEAVREARVPLLSADTCQKALGPGLS 272

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVI-GIVSYGLVCGSQGLPSVYTKVHLYT 350
            ..|..|||.::...|:|.||||||:....| .|..::|: |:.|:|..||..|.|.|||:|.::.
  Rat   273 PSTMLCAGYLAGGIDSCQGDSGGPLTCSEP-GPRPREVLFGVTSWGDGCGEPGKPGVYTRVAVFK 336

  Fly   351 DWIE 354
            ||::
  Rat   337 DWLQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/264 (31%)
Tryp_SPc 102..353 CDD:214473 82/261 (31%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 83/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.