DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Ctrc

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:284 Identity:83/284 - (29%)
Similarity:118/284 - (41%) Gaps:60/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SACQSTPF-------IVGGTKASGKEFPFMALIGTHRPNKSKSDINW--DCGGSVVHPKFVLTAA 149
            |.|.:..|       :|||..|....:|:...:      :...|..|  .||||::....|||||
  Rat    15 SCCGNPAFPPNLSTRVVGGEDAVPNSWPWQVSL------QYLKDDTWRHTCGGSLITTSHVLTAA 73

  Fly   150 HCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYV-VHPGYDTEDEEQGFK 213
            ||:..|               |..|:|...||.|.:|.....:..|:.: ||..::    .....
  Rat    74 HCINKD---------------FTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWN----RLFLW 119

  Fly   214 NDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQ-----VTAAGWGFTADGVKSSHLLKVNLQRF- 272
            ||||:::|....|.::.:...|: |:.|:.:.|     ||  |||........:.:|:..||.. 
  Rat   120 NDIAIIKLAEPVELSNTIQVACI-PEEGSLLPQDYPCYVT--GWGRLWTNGPIAEVLQQGLQPIV 181

  Fly   273 SDEVCQKRLRFSIDTR-TQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK-----QVIGIVSYG 331
            |...|.:...:.|..| |..|||. ......||||||||:       .|..     ||.||||:|
  Rat   182 SHATCSRLDWWFIKVRKTMVCAGG-DGVISACNGDSGGPL-------NCQAEDGSWQVHGIVSFG 238

  Fly   332 LV--CGSQGLPSVYTKVHLYTDWI 353
            ..  |.....|.|:|:|..|.|||
  Rat   239 SSSGCNVHKKPVVFTRVSAYNDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/269 (30%)
Tryp_SPc 102..353 CDD:214473 78/267 (29%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 78/268 (29%)
Tryp_SPc 30..265 CDD:238113 80/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.