DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and etaTry

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:273 Identity:79/273 - (28%)
Similarity:114/273 - (41%) Gaps:53/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKA 159
            :.||...||||...|.....:  ::...|.:.|.|.....|||.::....:.|||||:.      
  Fly    21 SAQSDGRIVGGADTSSYYTKY--VVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVY------ 77

  Fly   160 ERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRK 224
                 |.::..|:|..|: |.....:..:|   ||...:.|..|::...:    ||||||.:|..
  Fly    78 -----NREAENFLVVAGD-DSRGGMNGVVV---RVSKLIPHELYNSSTMD----NDIALVVVDPP 129

  Fly   225 AEFNDHVAAVCLPPDSGNDVQ-------------QVTAAGWGFTAD-GVKSSHLLKVNLQRFSDE 275
                       ||.||.:.::             |.|.:|||:|.: |:.|..|.:|.:.....|
  Fly   130 -----------LPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSE 183

  Fly   276 VCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLP 340
            .||:...:...:....|||......|.|.||||||:.|.:.|       .||||:|..|.....|
  Fly   184 KCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKL-------AGIVSWGEGCARPNYP 241

  Fly   341 SVYTKVHLYTDWI 353
            .||..|..|.|||
  Fly   242 GVYANVAYYKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/266 (29%)
Tryp_SPc 102..353 CDD:214473 75/264 (28%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 75/265 (28%)
Tryp_SPc 28..257 CDD:238113 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.