DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and f9a

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_878288.2 Gene:f9a / 359826 ZFINID:ZDB-GENE-030714-2 Length:503 Species:Danio rerio


Alignment Length:263 Identity:83/263 - (31%)
Similarity:123/263 - (46%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF-MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPN 165
            |:||..|...|.|: :||:       |:|.....||||:::|.:|:||||||..:.:.:      
Zfish   254 IIGGNSALPGEIPWQVALV-------SRSTQQVFCGGSILNPLWVITAAHCLLGNHNGS------ 305

  Fly   166 FDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDH 230
                 |.:|:||.|.:..  :...|:..|:..:.||.|::  :...|.:||||:.|.........
Zfish   306 -----FYIRVGEHDVSKI--EGTEQNVDVIKLISHPRYNS--KVSLFNHDIALLRLRSPIRLTPT 361

  Fly   231 VAAVCLPP--------DSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSID 286
            |..:||.|        .||.   ..|.:||| ....|..::.|.|:.|......||::.....| 
Zfish   362 VRPICLGPMVFSNTLLQSGT---LATVSGWGRVRFQGRSAATLQKIELPYVDRTVCKESSSDPI- 422

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTD 351
            |...||||...|..|.|.||||||..::   |.....:.||:|:|..|..:|...|||:|..|..
Zfish   423 THFMFCAGHSDSPKDACQGDSGGPHVMR---YHNTWFLTGIISWGEECAKKGKYGVYTQVGNYYR 484

  Fly   352 WIE 354
            ||:
Zfish   485 WIQ 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/263 (32%)
Tryp_SPc 102..353 CDD:214473 81/260 (31%)
f9aNP_878288.2 GLA 19..83 CDD:214503
EGF_CA 84..120 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 253..486 CDD:214473 81/260 (31%)
Tryp_SPc 254..489 CDD:238113 83/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.