DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Jon44E

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:263 Identity:73/263 - (27%)
Similarity:113/263 - (42%) Gaps:51/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |..|..|...:.|:  ::|.     |.:|..:.||||::...:|||||||..:..........:|
  Fly    41 ITNGYPAYEGKIPY--IVGL-----SFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASF 98

  Fly   167 DSPKFVVRLGELDYN---STTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
            ..        |..|.   |.:|  ::|         ||     |......|||||:.:.. .:|.
  Fly    99 RH--------EAQYTHWVSRSD--MIQ---------HP-----DWNDFLNNDIALIRIPH-VDFW 138

  Fly   229 DHVAAVCLPPDSGNDVQQ------VTAAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSID 286
            ..|..|.||  |.||...      ..|:|||.|.:....|:.|. |::|...:..|:.....:..
  Fly   139 SLVNKVELP--SYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYI 201

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYT 350
            |....|..:...:: :|:||||||:.:...     .:::||||:|...| :.|.|:.:|:|..|.
  Fly   202 TDNTICINTDGGKS-SCSGDSGGPLVLHDN-----NRIVGIVSFGSGEGCTAGRPAGFTRVTGYL 260

  Fly   351 DWI 353
            |||
  Fly   261 DWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/263 (28%)
Tryp_SPc 102..353 CDD:214473 71/261 (27%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/261 (27%)
Tryp_SPc 41..266 CDD:238113 73/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.