DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG30371

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:416 Identity:104/416 - (25%)
Similarity:165/416 - (39%) Gaps:87/416 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPGIQILLLIASVSVVTEYCDNGTGECKELTPSDCPVIFY-NQHLIGAEVKY-----CDEFNDIV 62
            ||.|.:||...:|....|.|||........|..:.|  :| |.:..|...:|     .|.:..:.
  Fly     5 LPLISLLLFAPTVLAYFEGCDNTFNLSPGTTYVESP--YYPNNYPGGTSCRYKFTAPLDYYIQVQ 67

  Fly    63 C-CPIP------------LDHQN---LKPAEQ------------------------TRPFEKQCK 87
            | ..||            ||.:.   ::.||.                        |:....:| 
  Fly    68 CSLGIPKGNGQCTTDNFWLDTEGDLLMRGAENFCGSGTLSRESLFTELVFAYISTGTKGGSFKC- 131

  Fly    88 QYNEVRSAC----QSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTA 148
            ....|:..|    .:|..|..|.:|:..|||.||.:.....|::..     |||::|..:::|||
  Fly   132 TLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQASF-----CGGTIVAHRYILTA 191

  Fly   149 AHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK 213
            |||: ...|:|..:         |..:|..|..:.:.....|.:.:...:.|..|.::.:   ..
  Fly   192 AHCI-YQVSRATNI---------VAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPD---VN 243

  Fly   214 NDIALVELDRKAEFNDHVAAVCLPPDSGN-----DVQQVTAAGWGFTADGVKSSHLLKVNLQRFS 273
            ||||::......:::..|..:||||...:     |:..|...|..|.| |..|:.|.|:||...:
  Fly   244 NDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGYGTVFFA-GPTSTSLQKINLNVVT 307

  Fly   274 DEVCQKRLRFSIDTRT-QFCAGSMSSQA-DTCNGDSGGPIFVQHPLYPCLKQ-VIGIVSYGLVCG 335
            ::.||..........| |.|....|... |:|..|||||:.::..     :| ::||:|||..|.
  Fly   308 NQDCQTEYNNVATIYTGQMCTYDYSGTGRDSCQFDSGGPVILRKS-----RQFLVGIISYGKSCA 367

  Fly   336 SQGLP-SVYTKVHLYTDWIESIVWGN 360
            ....| .|.|::..|..||...: ||
  Fly   368 ESQYPMGVNTRITSYISWIRQKI-GN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/262 (28%)
Tryp_SPc 102..353 CDD:214473 71/259 (27%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042 10/44 (23%)
Tryp_SPc 149..386 CDD:214473 71/260 (27%)
Tryp_SPc 150..389 CDD:238113 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.