DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and KLK3

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:281 Identity:83/281 - (29%)
Similarity:118/281 - (41%) Gaps:67/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            ||||.:......|:..|:.    ::.::    .|||.:|||::|||||||:..            
Human    25 IVGGWECEKHSQPWQVLVA----SRGRA----VCGGVLVHPQWVLTAAHCIRN------------ 69

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGF-------KNDIALVELDRK 224
               |.|:.||........|..  |.|:|.:...||.||....:..|       .:|:.|:.|...
Human    70 ---KSVILLGRHSLFHPEDTG--QVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEP 129

  Fly   225 AEFNDHVAAVCLP---PDSGNDVQQVTAAGWGFTADGVKSSHLLK------VNLQRFSDEVC--- 277
            ||..|.|..:.||   |..|....   |:|||    .::....|.      |:|...|::||   
Human   130 AELTDAVKVMDLPTQEPALGTTCY---ASGWG----SIEPEEFLTPKKLQCVDLHVISNDVCAQV 187

  Fly   278 --QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL-VCGSQGL 339
              ||..:|.:      |||..:....||:||||||:.       |...:.||.|:|. .|.....
Human   188 HPQKVTKFML------CAGRWTGGKSTCSGDSGGPLV-------CNGVLQGITSWGSEPCALPER 239

  Fly   340 PSVYTKVHLYTDWIESIVWGN 360
            ||:||||..|..||:..:..|
Human   240 PSLYTKVVHYRKWIKDTIVAN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/275 (30%)
Tryp_SPc 102..353 CDD:214473 80/272 (29%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 82/275 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.