DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and F25E5.7

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_872235.1 Gene:F25E5.7 / 353443 WormBaseID:WBGene00017788 Length:379 Species:Caenorhabditis elegans


Alignment Length:261 Identity:61/261 - (23%)
Similarity:89/261 - (34%) Gaps:76/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KQYNEVRSACQSTPF----IVGGTKASGKEFPFMALIG----THRPNKSKSDINWDCGGSVVHPK 143
            |:...::|.|..|||    |:.|......|.|:.....    ..:..|.|. :.....|:|:.|.
 Worm    23 KENQVLQSYCGRTPFLQRRIINGKPLEAFENPWAVAAQFQYYVQKDGKPKR-LVMVFPGTVISPY 86

  Fly   144 FVLT---------------------AAHCLE----TDESKAERLDPNFDSPKFVVRLGELDYNST 183
            .:||                     ...||.    ..|...:|.|...|..||       |....
 Worm    87 HILTYNLVRSYDGVFGFQHKENMTSNGTCLGEHYFLPEEYTDRFDIIMDRSKF-------DMTRK 144

  Fly   184 TDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVT 248
            ..| ||:  ||:  |::...|....:      :.::||.:..|.|..:..||:    .||.|...
 Worm   145 FQD-LVR--RVI--VINGCPDVNSAK------VLILELKKPLELNPSIWPVCI----SNDPQLFD 194

  Fly   249 AAG----WGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSG 308
            .:.    .|..|.||.:|.|.| ||        |.....||       ||.::.::...|..|||
 Worm   195 RSSDFSVSGIDAKGVLNSGLFKPVN--------CSVEGPFS-------CAEAVDNKQRMCAYDSG 244

  Fly   309 G 309
            |
 Worm   245 G 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 55/242 (23%)
Tryp_SPc 102..353 CDD:214473 55/242 (23%)
F25E5.7NP_872235.1 DUF316 2..297 CDD:252150 61/261 (23%)
Tryp_SPc 42..260 CDD:304450 55/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.