DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss21

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:314 Identity:84/314 - (26%)
Similarity:137/314 - (43%) Gaps:70/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NLKPAEQTRPFEKQCKQYNEVRSAC--QSTPF-IVGGTKASGKEFPFMALI---GTHRPNKSKSD 130
            ::||.:..:|   :.::.|.:...|  ::.|. ||||.:|....:|:...:   |.|.       
  Rat    28 HVKPVDPEKP---ELQEANLLSGPCGHRTIPSRIVGGEEAELGRWPWQGSLRVWGNHL------- 82

  Fly   131 INWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNST--TDDALVQDFR 193
                ||.::::.::|||||||.:.|.      || ||   :.|:.|||....:  ...|....::
  Rat    83 ----CGATLLNRRWVLTAAHCFQKDN------DP-FD---WTVQFGELTSRPSLWNLQAYSNRYQ 133

  Fly   194 VVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVT--AAGWGFTA 256
            :.:..:.|.| ||.    |.:||||::|.....:::.:..:||...:.....:..  ..|||  |
  Rat   134 IEDIFLSPKY-TEQ----FPHDIALLKLSSPVTYSNFIQPICLLNSTYKFANRTDCWVTGWG--A 191

  Fly   257 DGVKSSHLLKVNLQR-----FSDEVCQ---KRLRFSIDT-RTQFCAGSMSSQADTC--------- 303
            .|...|..|..|||.     .::.:|.   |:..|.|:. ....||||.....|.|         
  Rat   192 IGEDESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRINIWGDMVCAGSPEGGKDACFAKLTYAAP 256

  Fly   304 NGDSGGPIFVQHPLYPCLKQV----IGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            .||||||:.       |.:..    :|:||:|:.||....|.|||.:..:.:||
  Rat   257 QGDSGGPLV-------CNQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/281 (28%)
Tryp_SPc 102..353 CDD:214473 76/279 (27%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 76/280 (27%)
Tryp_SPc 58..304 CDD:238113 78/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.