DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and SPH93

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:239 Identity:78/239 - (32%)
Similarity:117/239 - (48%) Gaps:49/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVH 200
            |||::.|..|||.||.:.|.|:            :.|||.|:.|..|..:..|.:...|...|:|
  Fly   272 GGSLIQPNVVLTVAHRVITIET------------ELVVRAGDWDLKSDREIFLSEQREVERAVIH 324

  Fly   201 PGYDTEDEEQGFK---NDIALVELDRKAEFNDHVAAVCLP-PDSGNDVQQVTAAGWGFT--ADGV 259
            .|:|       ||   |::||:.|:...:.|||:..:||| |:.....::.|.||||..  .|..
  Fly   325 EGFD-------FKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQR 382

  Fly   260 KSSHLLKVNLQRFSDEVCQKRLR-------FSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPL 317
            .|:.|.||.|...:..||:|.||       |.: .:...|||....: |||.||.|..:|     
  Fly   383 YSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFEL-PKNIICAGGELGR-DTCTGDGGSALF----- 440

  Fly   318 YPC--------LKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
              |        :.:..|||::|:.||.:|:|::||:|..:|:||
  Fly   441 --CSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/239 (33%)
Tryp_SPc 102..353 CDD:214473 76/237 (32%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 78/239 (33%)
Tryp_SPc 252..482 CDD:214473 76/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.