DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG4793

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:379 Identity:98/379 - (25%)
Similarity:160/379 - (42%) Gaps:71/379 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQILLLIASVS-VVTEYCDNGTGE-------CKELTPSDCPVIFY------NQHLIGAEV-KYCD 56
            :.||||:...| :...:|.....:       |:..|.:..|:|.:      ||   |.|. :.|.
  Fly     4 LSILLLVLGFSRIQALFCGGSMAKECVQRNRCRIGTETGRPIIDFRGLNNGNQ---GCESGQTCC 65

  Fly    57 EFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTK--ASGKEFPFM-AL 118
            ...:|:..|:..|:|         |...:|...|.:     ...|.:...:  |...|.|:| ||
  Fly    66 PKTEILQYPVQADNQ---------PLPTECGHVNRI-----GVGFTITNARDIAQKGELPWMVAL 116

  Fly   119 IGTHRPNKSKSDINWDCGGSVVHPKFVLTAA-HCLETDESKAERLDPNFDSPKFVVRLGELDYNS 182
            :    .::|:..:.   |||::....|||:: ..||..|.            ..:||.||.|:.|
  Fly   117 L----DSRSRLPLG---GGSLITRDVVLTSSTKTLEVPEK------------YLIVRAGEWDFES 162

  Fly   183 TTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDV-QQ 246
            .|::...:|..:...|.|.....|:.    .|:.||:.|.|..:.:.|:..:||||.:.|.: .:
  Fly   163 ITEERAHEDVAIRKIVRHTNLSVENG----ANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR 223

  Fly   247 VTAAGWG--FTADGVKSSHLLKVNLQRFSDEVCQKRLR------FSIDTRTQFCAGSMSSQADTC 303
            ...:|||  ...|....:.|.|:.|......|||.:|:      |.:| .:..|||....: |||
  Fly   224 CIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILD-NSLICAGGEPGK-DTC 286

  Fly   304 NGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            .||.|.|:.......|...:::|||::|..||.. ||:.||.|.....||::.:
  Fly   287 KGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/266 (28%)
Tryp_SPc 102..353 CDD:214473 73/263 (28%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 75/257 (29%)
Tryp_SPc 105..335 CDD:214473 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.