DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG18477

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:382 Identity:100/382 - (26%)
Similarity:162/382 - (42%) Gaps:70/382 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYALPGIQILLLIASVSVVTEYCDNGTGECKELTPSDCPVIFYNQ----HLIGAEVKY------- 54
            ||.:..|..|:|:|...       ...|:..||..| |.....:|    |:...::::       
  Fly     4 MYGIIAIVSLILVAGQV-------QAQGQNAELNQS-CGASNEHQCVPRHMCKVKIEFRMAMTYR 60

  Fly    55 ---CDEFNDIVCCPIPLDHQNLKPAEQ----TRPF-EKQCKQYNEVRSACQSTPFIVGGT-KASG 110
               |  .:..:|||     :||...|.    ..|. :.||   ..|.|...:..|....| .|..
  Fly    61 NLGC--VSTAICCP-----KNLIIKEPRLIINEPITDPQC---GFVNSKGVTFSFREEDTGLAQE 115

  Fly   111 KEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRL 175
            .|.|:|..:...|.:      ::..||:::.|..|:||....|           |..:.:.|||.
  Fly   116 AEVPWMVALLDARTS------SYVAGGALIAPHVVITARQRTE-----------NMTASQLVVRA 163

  Fly   176 GELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDS 240
            ||.|:::.|:.....|..:.:.|.|||::.|:.    .|::|||.|.|....:.|:..:|:|...
  Fly   164 GEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENG----ANNVALVFLRRSLTSSRHINPICMPSAP 224

  Fly   241 GN-DVQQVTAAGWGFTA--DGVKSSHLLKVNLQRFSDEVCQKRLR------FSIDTRTQFCAGSM 296
            .| |..:....|||..:  |....:.|.|::|.......|:::||      |.:| .:..|||..
  Fly   225 KNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELD-NSLMCAGGE 288

  Fly   297 SSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ..: |:|.||.|.|:.......|...::.|||::|:.||..|:|:|||.|....:||
  Fly   289 PGK-DSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/262 (28%)
Tryp_SPc 102..353 CDD:214473 72/260 (28%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 71/253 (28%)
Tryp_SPc 113..344 CDD:238113 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.