DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and PRSS48

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:282 Identity:75/282 - (26%)
Similarity:122/282 - (43%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            :|||..|:...:|:.  :..|      .|.|:.||||:|..:.:||||||::          |.:
Human    51 VVGGQDAAAGRWPWQ--VSLH------FDHNFICGGSLVSERLILTAAHCIQ----------PTW 97

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQ-DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDH 230
            .:..:.|.||.:    |..|:..: .:.|...|:||.|      |....|:||::|..:..|...
Human    98 TTFSYTVWLGSI----TVGDSRKRVKYYVSKIVIHPKY------QDTTADVALLKLSSQVTFTSA 152

  Fly   231 VAAVCLPPDSGNDVQQVT------AAGWG---FTADGVKSSHLLKVNLQRFSDEVCQKRLR---- 282
            :..:|||    :..:|:.      ..|||   .::|....|.|.:..:.....:.|::...    
Human   153 ILPICLP----SVTKQLAIPPFCWVTGWGKVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGI 213

  Fly   283 -----FSIDTRTQFCAGSMSSQADTCNGDSGGP-------IFVQHPLYPCLKQVIGIVSYGLVCG 335
                 ..:....:.|||...:..|:|.||||||       :::|          .|:||:||.||
Human   214 FLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQ----------TGVVSWGLECG 268

  Fly   336 SQGLPSVYTKVHLYTDWIESIV 357
             :.||.|||.|..|..||.:.:
Human   269 -KSLPGVYTNVIYYQKWINATI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/279 (27%)
Tryp_SPc 102..353 CDD:214473 73/276 (26%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 73/276 (26%)
Tryp_SPc 51..288 CDD:238113 75/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.