DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and OVCH2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:321 Identity:88/321 - (27%)
Similarity:135/321 - (42%) Gaps:73/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KPAEQTRPFEKQCKQYNEVRSACQSTPF--------IVGGTKASGKEFPFMALIGTHRPNKSKSD 130
            |.|..:.|....|.|     |..:..|:        |:||::.....:|:...:        |..
Human    25 KSATLSLPKAPSCGQ-----SLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVSL--------KQR 76

  Fly   131 INWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVV 195
            ....||||:|.|::|:|||||: .:.:....|:         |..||.|.:.|  |...|...:.
Human    77 QKHICGGSIVSPQWVITAAHCI-ANRNIVSTLN---------VTAGEYDLSQT--DPGEQTLTIE 129

  Fly   196 NYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQ-------VTAAGWG 253
            ..::||.:.|   ::....||||:::....:|...|..:|||     ::::       .|.||||
Human   130 TVIIHPHFST---KKPMDYDIALLKMAGAFQFGHFVGPICLP-----ELREQFEAGFICTTAGWG 186

  Fly   254 -FTADGVKSSHLLKVNLQRFSDEVCQK---RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQ 314
             .|..||.|..|.:|||...:.|.|..   .|:..|..:|..|.|......|.|.|||||.:..:
Human   187 RLTEGGVLSQVLQEVNLPILTWEECVAALLTLKRPISGKTFLCTGFPDGGRDACQGDSGGSLMCR 251

  Fly   315 HPLYPCLKQ----VIGIVSYGLVCG----------SQGLPSVYTKVHLYTDWI-ESIVWGN 360
            :      |:    :.|:.|:||.||          .||.|.::|.:.....|| |.|..||
Human   252 N------KKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGSPGIFTDISKVLPWIHEHIQTGN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/279 (28%)
Tryp_SPc 102..353 CDD:214473 75/275 (27%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 75/276 (27%)
Tryp_SPc 56..301 CDD:238113 77/278 (28%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.