DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and PRSS38

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:267 Identity:75/267 - (28%)
Similarity:110/267 - (41%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            |:||..|..:::|:...:   |.|           .||||:::..:||:||||...|:       
Human    60 ILGGVPAPERKWPWQVSVHYAGLH-----------VCGGSILNEYWVLSAAHCFHRDK------- 106

  Fly   164 PNFDSPKFVVRLGELDY--NSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAE 226
             |.......|.|..|..  |.|      |.:.|...::||.|:......|   |:|||:|..:..
Human   107 -NIKIYDMYVGLVNLRVAGNHT------QWYEVNRVILHPTYEMYHPIGG---DVALVQLKTRIV 161

  Fly   227 FNDHVAAVCL-PPDSGNDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRL-RFSIDTR 288
            |::.|..||| .|:.........|.|||..: .|..|..|.::.|....:..|.... ..|....
Human   162 FSESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMP 226

  Fly   289 TQFCAGSMSSQADTCNGDSGGPI-------FVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKV 346
            ...|||.:.:....|.||||||:       ::|          |||||:|..|.:...|.||..|
Human   227 DMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQ----------IGIVSWGRGCSNPLYPGVYASV 281

  Fly   347 HLYTDWI 353
            ..::.||
Human   282 SYFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/267 (28%)
Tryp_SPc 102..353 CDD:214473 73/265 (28%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 75/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.