DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and PRSS53

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:314 Identity:72/314 - (22%)
Similarity:107/314 - (34%) Gaps:105/314 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVV 173
            |:|:.|.:   |.|           .|.||:|...:|||||||.|    ||...:.|    .:.|
Human    47 EWPWQASVRRQGAH-----------ICSGSLVADTWVLTAAHCFE----KAAATELN----SWSV 92

  Fly   174 RLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPP 238
            .||.|.....:..|  ::..|....:...|:  ...||  :|:||::|   |....| ..:|||.
Human    93 VLGSLQREGLSPGA--EEVGVAALQLPRAYN--HYSQG--SDLALLQL---AHPTTH-TPLCLPQ 147

  Fly   239 DS-----GNDVQQVTAAGWG-FTADG-----VKSSHLLKVNLQRFSDEVCQ-------------- 278
            .:     |   ....|.||. .|:||     :|....|.:.....|...|.              
Human   148 PAHRFPFG---ASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLA 209

  Fly   279 ------------KRLRFSIDTRT---------------------QFCAGSMSSQADTCNGDSGGP 310
                        :.||..:.:|.                     ..|.|........|.||||||
Human   210 PAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGP 274

  Fly   311 IFVQHPLYPCLKQ-----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWG 359
            :.       ||:.     ..||:|:...|..:..|.:.|....::.|:::.|.|
Human   275 VL-------CLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSWLQARVQG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 70/309 (23%)
Tryp_SPc 102..353 CDD:214473 69/306 (23%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 70/307 (23%)
Tryp_SPc 43..314 CDD:214473 69/305 (23%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.