DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG31954

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:295 Identity:81/295 - (27%)
Similarity:133/295 - (45%) Gaps:47/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSK 128
            |.||      :|.::.|..|...|  |..:.:.:....||||.:.:..:.|....:.|      .
  Fly    21 CLIP------QPVKRQRSLEDVIK--NPWKLSPRLDGRIVGGHRINITDAPHQVSLQT------S 71

  Fly   129 SDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFR 193
            |.|   ||||::..:::||||||  |....|:||.....:.:| .|.|:|             .|
  Fly    72 SHI---CGGSIISEEWILTAAHC--TYGKTADRLKVRLGTSEF-ARSGQL-------------LR 117

  Fly   194 VVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGN--DVQQVTAAGWGFTA 256
            |...|.|..::..:.:.    |.:|::|....:|::...||.||.....  |.:....:|||.|.
  Fly   118 VQKIVQHAQFNYTNVDY----DFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQ 178

  Fly   257 DGVKSSHLLK-VNLQRFSDEVC-QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYP 319
            :.::|...|: |.:...:.|:| :|..::...|....|||.:....|.|.||||||:..:.    
  Fly   179 NLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSES---- 239

  Fly   320 CLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
              .:::|:||:|..|.....|.||::|....|||:
  Fly   240 --GELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/257 (28%)
Tryp_SPc 102..353 CDD:214473 71/254 (28%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 71/255 (28%)
Tryp_SPc 51..274 CDD:238113 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.