DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG40160

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:344 Identity:99/344 - (28%)
Similarity:143/344 - (41%) Gaps:95/344 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FND---------IVCC-----------PIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFI 102
            |||         .|||           |.|||.:..:|        :.|...|     .....|.
  Fly   111 FNDDDPICPASVDVCCDANRTLNKTLNPTPLDQRPNQP--------RGCGVRN-----TGGLDFT 162

  Fly   103 VGG---TKASGKEFPF-MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            :.|   .:|...|||: :||:  |..|     :::.|.||::|.:.|||||||:|          
  Fly   163 LSGVSQNEAGFGEFPWTVALL--HSGN-----LSYFCAGSLIHKQVVLTAAHCVE---------- 210

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
             :..:..|.||.||.|..:..:....|:..|...::||.|:    .:....|.|||.|.:....:
  Fly   211 -SLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYN----RRSIAYDFALVILSQPVTLD 270

  Fly   229 DHVAAVCLP-----PDSGNDVQQVTAAGWG---FTADGVKSSHLLKVNLQRFSDEVCQKRLR--- 282
            ||:..:|||     |..||   ...:.|||   |.:.|..||.:.:|.|.......||.|||   
  Fly   271 DHINVICLPQQDDIPQPGN---TCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTR 332

  Fly   283 ----FSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK--------QVIGIVSYGLVCG 335
                |::| |:..|||.... .|||.||.|.|:       .|.:        |..|||::|:.|.
  Fly   333 LGPKFALD-RSFICAGGQRG-IDTCQGDGGAPL-------ACPRGSTRESRYQQTGIVAWGIGCN 388

  Fly   336 SQGLPSVYTKVHLYTDWIE 354
            .: :|:.|..|.|...||:
  Fly   389 DE-VPAAYANVALVRGWID 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/280 (30%)
Tryp_SPc 102..353 CDD:214473 83/277 (30%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 84/276 (30%)
Tryp_SPc 169..405 CDD:214473 82/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.