DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG3117

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:344 Identity:89/344 - (25%)
Similarity:146/344 - (42%) Gaps:71/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYN---- 90
            |:|..|      |::   ..:.::..||   .|||    :..|:....::.|      |::    
  Fly    36 CREEMP------FFD---FSSTIECSDE---EVCC----EKSNVIGMSKSPP------QHSVDTL 78

  Fly    91 ---EVRSACQSTPFIVGG-TKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTA 148
               ...:|...:|.:.|. ||.:  :||::..:   |::..           |||::.|..||||
  Fly    79 LRTSYPNALDGSPQVFGDQTKPN--QFPWVTALFAKGSYLG-----------GGSLITPGLVLTA 130

  Fly   149 AHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK 213
            ||.|       ..|.||    ..:||.||.|.:|:.......|.:|:..:.|..::....    .
  Fly   131 AHIL-------AGLSPN----DIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSG----A 180

  Fly   214 NDIALVELDRKAEFNDHVAAVCLP-PDSGNDVQQVTAAGWGF--TADGVKSSHLLKVNLQRFSDE 275
            ||:||:.||...|...::..:.|| ||...|.:..|.||||.  :.|....:...||:|......
  Fly   181 NDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESS 245

  Fly   276 VCQKRLRFS-IDTRTQ-----FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVC 334
            .||::||.: :.:..|     .|||....: |.|:...|..:|......|...:..||||:|:.|
  Fly   246 KCQRQLRLTKMGSNYQLPASLMCAGGEEGR-DVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGC 309

  Fly   335 GSQGLPSVYTKVHLYTDWI 353
            |...:|:.:|.|..:.:||
  Fly   310 GQANVPTTFTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/265 (28%)
Tryp_SPc 102..353 CDD:214473 73/263 (28%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 75/263 (29%)
Tryp_SPc 95..328 CDD:214473 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.