DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG4259

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:221 Identity:60/221 - (27%)
Similarity:94/221 - (42%) Gaps:25/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHP 201
            ||:::|..||||||.|..        ...:|   .|||.||.|.::|.|...| |..|:|.|.|.
  Fly    59 GSLINPNVVLTAAHILNG--------TTKYD---LVVRAGEWDTSTTADQQHV-DLEVLNIVSHE 111

  Fly   202 GYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCL-PPDSGNDVQQVTAAGWG-FTADGVKSSHL 264
            .::..:.|    |::||:.|....|...::..:.| ..::|.........||| ...:......:
  Fly   112 QFNRFNAE----NNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTV 172

  Fly   265 LK-VNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIV 328
            || |.:...|..:|..| :..|.   |.|...:  :...|:||.|.|:..:...||.....:|||
  Fly   173 LKTVQVDLLSMGMCSSR-KLPIQ---QICGKGL--EGIDCSGDGGAPLVCRILTYPYKYAQVGIV 231

  Fly   329 SYGLVCGSQGLPSVYTKVHLYTDWIE 354
            ::......:....|:|.|.....||:
  Fly   232 NWLSQKPVENTFIVFTNVAGLLPWID 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 60/221 (27%)
Tryp_SPc 102..353 CDD:214473 58/218 (27%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 60/221 (27%)
Tryp_SPc 39..256 CDD:214473 58/218 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.