DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG11911

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:266 Identity:78/266 - (29%)
Similarity:121/266 - (45%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 STPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERL 162
            :|.|::.||:|.....|::..:.|:....|..     |||::::..:::|||||:          
  Fly    33 ATGFVINGTEAEPHSAPYIVSLATNYLKHSHI-----CGGTLINKDWIVTAAHCI---------- 82

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGF-KNDIALVELDRKAE 226
                ..|..:..:..|...:..|: |.|..:|....||..|     ..|. ..||||:.::....
  Fly    83 ----SEPVGMSIIAGLHTRAEVDE-LTQQRQVDFGRVHEKY-----TGGVGPYDIALLHVNESFI 137

  Fly   227 FNDHVAAVCLPPDSGNDVQQVTAAGWG----FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSID- 286
            ||:.|....||........:....|||    :...|.|:  |..|..|..:.|.|::.|..|.. 
  Fly   138 FNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKT--LQTVTTQILNYEECKEELPESAPI 200

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLV-CGSQGLPSVYTKVHLYT 350
            ..:..|:.|:......||||||||:.|:....|  .::|||||:|.: ||...:||:||||..|.
  Fly   201 AESNICSSSLQQSKSACNGDSGGPLVVEFTNAP--SELIGIVSWGYIPCGLANMPSIYTKVSAYI 263

  Fly   351 DWIESI 356
            |||.:|
  Fly   264 DWITNI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/260 (29%)
Tryp_SPc 102..353 CDD:214473 73/257 (28%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 75/260 (29%)
Tryp_SPc 37..266 CDD:214473 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.