DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss53

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:269 Identity:66/269 - (24%)
Similarity:105/269 - (39%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLE---TDESKAERLDPNFDSPK 170
            |:|:.|.:   |.|           .|.||:|...:|||||||.|   |.|..:           
Mouse    47 EWPWQASVRRQGVH-----------ICSGSLVADTWVLTAAHCFEKMATAELSS----------- 89

  Fly   171 FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
            :.|.||.|.....:..|  ::..|....:...|:  ...||  :|:||::|.....    ...:|
Mouse    90 WSVVLGSLKQEGQSPGA--EEVGVAALQLPKAYN--HYSQG--SDLALLQLTHPTV----QTTLC 144

  Fly   236 LPPDSGNDVQQVT----------AAGWGFTADGVKSSHLLKVNLQRFSDEVC-------QKRLRF 283
            ||        |.|          |.||......| |..|..:.|:..|...|       .:||..
Mouse   145 LP--------QPTYHFPFGASCWATGWDQNTSDV-SRTLRNLRLRLISRPTCNCLYNRLHQRLLS 200

  Fly   284 SIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHL 348
            :.......|.|:...:...|.||||||:..:.|....::  :||:|:...|..:..|.:.|.:.:
Mouse   201 NPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQ--VGIISFTSKCAQEDTPVLLTDMAV 263

  Fly   349 YTDWIESIV 357
            ::.|:::.|
Mouse   264 HSSWLQAHV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 65/266 (24%)
Tryp_SPc 102..353 CDD:214473 64/263 (24%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113 65/266 (24%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.