DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPE6

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_552458.3 Gene:CLIPE6 / 3291431 VectorBaseID:AGAP011785 Length:374 Species:Anopheles gambiae


Alignment Length:385 Identity:96/385 - (24%)
Similarity:145/385 - (37%) Gaps:86/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIQILLLIAS------VSVVTEYCDNGTGECKELTPSD------CPVIFYNQHLIGAEVKYCDEF 58
            |..::||:|:      ..|..:..|..| |..|..|.:      |.:.|           .|.| 
Mosquito     6 GTFLILLVAAAHFTSCTEVPADRVDPET-EPTEQQPRNRTCNGICVIYF-----------QCHE- 57

  Fly    59 NDIVCCPIPLDHQNLKP--AEQTRPFEKQ--CKQYNEVRSACQSTPFIVG--------GTKASGK 111
            |.||  | |:..:...|  :|...|:.|.  |    |.|||.:......|        |.::..:
Mosquito    58 NKIV--P-PMLGKRFVPDDSEPECPYRKYVCC----EKRSALEGPRTTTGKPTSDATCGFRSRKR 115

  Fly   112 EFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPK--FVVR 174
            .||:|.::.....:...:.:.:.||.|::.|...||.|||:             .|.||  .|:|
Mosquito   116 TFPWMVIVYREELDDPTNQLFYQCGASLIAPNVALTVAHCV-------------LDQPKERLVIR 167

  Fly   175 LGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPD 239
            .||  :...|:.   |:.||...:.....:.    ....||:||:.|....:..:.:..:||||.
Mosquito   168 AGE--WRLETEH---QNRRVAQLITRKASNV----HSLANDVALIVLSEPFQLTETIQPICLPPK 223

  Fly   240 SGN-DVQQVTAAGWG--FTADGVKSSHLLKVNLQRFSDE-------VCQKRLRFSIDTRTQFCAG 294
            ..: |.......||.  ...||.  :.|:|    |...|       ||...|......:...|||
Mosquito   224 GTSFDRSDCFTVGWDRIIVCDGY--AMLVK----RIWGEQAVVPHDVCPHVLPPMRPVQPFLCAG 282

  Fly   295 SMSSQADTCNGDSGG-PIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            .:.:| |.|..:|.| |:....|..|......|||:....|...|.|.::.:|..|.|||
Mosquito   283 GVITQ-DMCPRNSTGFPLVCPIPGSPHHYYQAGIVAMPNGCDDNGAPGIFVQVAHYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 68/273 (25%)
Tryp_SPc 102..353 CDD:214473 66/271 (24%)
CLIPE6XP_552458.3 Tryp_SPc 109..344 CDD:238113 67/262 (26%)
Tryp_SPc 109..341 CDD:214473 65/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.